PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G060900.1.p
Common NamePRUPE_ppa017460mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GATA
Protein Properties Length: 324aa    MW: 35240 Da    PI: 6.6433
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G060900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.24.1e-17217251135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C +C + kTp+WR gp g+ktLCnaCG++y++ +l
  Prupe.3G060900.1.p 217 CLHCAAEKTPQWRTGPMGPKTLCNACGVRYKSGRL 251
                         99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.2E-8616302IPR016679Transcription factor, GATA, plant
SMARTSM004014.0E-16211261IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.36211247IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.9E-14212248IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.76E-14213274No hitNo description
CDDcd002026.54E-13216263No hitNo description
PfamPF003207.8E-15217251IPR000679Zinc finger, GATA-type
PROSITE patternPS003440217242IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MELPEFYLGG YFDAGASDFL PEKKPAAAGD QFTVDDLLDF SNEDALVADG GFLDAAADSS  60
AITAVDSCNS SVSGGEPQFS GNRNFGDSQF SGDLCVPHDD LAELEWLSNF VEDSFSAEKD  120
LQALQFLSMT TTKPQTPETS SSSETNQNAP LFHPETPLPG KARSKRSRAA PGDWSTRLLH  180
LVTPNDTIKP PKTTTCKKKD GIGGNSNSGS DTSGRKCLHC AAEKTPQWRT GPMGPKTLCN  240
ACGVRYKSGR LVPEYRPAAS PTFVSARHSN SHRKVLELRR QKEVHRSHQH QFLSKSSIFG  300
VSNGGHDEYL IRHHSVNDFR QMM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007217275.10.0hypothetical protein PRUPE_ppa017460mg
SwissprotO826322e-81GATA9_ARATH; GATA transcription factor 9
TrEMBLM5WXU80.0M5WXU8_PRUPE; Uncharacterized protein
STRINGGLYMA07G01960.21e-133(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.13e-72GATA transcription factor 9